Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM Family Member 7/SLAMF7/CD319/CRACC (C-6His)

Source: Human Cells. MW :23.3kD. Recombinant Human SLAMF7 is produced by our Mammalian expression system and the target gene encoding Ser23-Ser225 is expressed with a 6His tag at the C-terminus. SLAMF7 is a single-pass type I membrane protein and contains 1 Ig-like C2-type (immunoglobulin-like) domain. SLAMF7 is expressed in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-cell lines, or T-cell lines. Although the cytoplasmic domain of CS1 contains immunoreceptor tyrosine-based switch motifs (ITSM), which enables to recruite signaling lymphocyte activation molecule (SLAM) -associated protein (SAP/SH2D1A), it activates NK cells in the absence of a functional SAP. SLAMF7 positively regulated natural killer cell functions by a mechanism dependent on the adaptor EAT-2 but not the related adaptor SAP. However, in the absence of EAT-2, CRACC potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.

Product Specifications

Gene Name

SLAMF7

Gene ID

57823

UniProt

Q9NQ25

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1460 Protein Vector (Rat) (pPM-C-HA)
PV288252 500 ng

Olr1460 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Reagent soda ash Rim, RB, 55x11,0x0,7-0,8mm PU:500 pcs. A405511000811
1211923 500 PCS/PCK

Reagent soda ash Rim, RB, 55x11,0x0,7-0,8mm PU:500 pcs. A405511000811

Sign In for Pricing
View Details
SIPA1L1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2151002 1.0 µg DNA

SIPA1L1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human CTSC knockout cell line
ABC-KH3736 1 Vial

Human CTSC knockout cell line

Sign In for Pricing
View Details
Recombinant Anti-Cytochrome P450 4A11 Rabbit mAb
CMA4664-01 30 µL

Recombinant Anti-Cytochrome P450 4A11 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cytochrome P450 4A11 Rabbit mAb
CMA4664-02 50 μL

Recombinant Anti-Cytochrome P450 4A11 Rabbit mAb

Sign In for Pricing
View Details