Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PD-L1/B7-H1/CD274 (C-6His)

Source: Human Cells. MW :26.33kD. Recombinant Human Programmed Cell Death 1 Ligand 1 is produced by our Mammalian expression system and the target gene encoding Phe19-Thr239 is expressed with a 6His tag at the C-terminus. CD274, also known as B7-H1 or programmed death ligand 1 (PD-L1), is a 40 kD type I transmembrane protein and a member of the B7 family within the immunoglobulin receptor superfamily. Programmed death-1 ligand-1 (PD-L1, CD274, B7-H1) has been identified as the ligand for the immunoinhibitory receptor programmed death-1 (PD1/PDCD1) and has been demonstrated to play a role in the regulation of immune responses and peripheral tolerance. By binding to PD1 on activated T-cells and B-cells, PD-L1 may inhibit ongoing T-cell responses by inducing apoptosis and arresting cell-cycle progression. Accordingly, it leads to growth of immunogenic tumor growth by increasing apoptosis of antigen specific T cells and may contribute to immune evasion by cancers. PD-L1 thus is regarded as promising therapeutic target for human autoimmune disease and malignant cancers.

Product Specifications

Gene Name

CD274

Gene ID

29126

UniProt

Q9NZQ7

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mmu-miR-466i-5p miRNA Mimic
CMM1001-01 5 nmol

Mmu-miR-466i-5p miRNA Mimic

Ask
View Details
Mmu-miR-466i-5p miRNA Mimic
CMM1001-02 10 nmol

Mmu-miR-466i-5p miRNA Mimic

Ask
View Details
PCB (PC) (NM_022172) Human 3' UTR Clone
SC205033 10 µg

PCB (PC) (NM_022172) Human 3' UTR Clone

Ask
View Details
Ubiquitin (GST tagged)
LF-P0041 0.5 mg

Ubiquitin (GST tagged)

Ask
View Details
PPP3CB Rabbit Polyclonal Antibody
TA344738 100 µL

PPP3CB Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit I (nuoI)
MBS1280577-01 0.02 mg (E-Coli)

Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit I (nuoI)

Ask
View Details