Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

Source: Human Cells. MW :25.34kD. Recombinant Human KIR2DL4 is produced by our Mammalian expression system and the target gene encoding Trp22-His242 is expressed with a 6His tag at the C-terminus. Killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4) is a Single-pass type I membrane protein and contains 2 Ig-like C2-type (immunoglobulin-like) domains.It belongs to the immunoglobulin superfamily. KIR2DL4 is expressed in all NK cells and some T cells. KIR2DL4 activates the cytotoxicity of NK cells, despite the presence of an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic tail. The ITIM was not necessary for activation of lysis by KIR2DL4. The activation signal of KIR2DL4 was sensitive to inhibition by another ITIM-containing receptor. The activation-deficient mutant of KIR2DL4 inhibited the signal delivered by the activating receptor CD16.

Product Specifications

Gene Name

KIR2DL4

Gene ID

3805

UniProt

Q99706

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal NEK3 Antibody [PE]
NBP2-98357PE 0.1 mL

Rabbit Polyclonal NEK3 Antibody [PE]

Ask
View Details
Mouse PKD1L2 siRNA
abx928716-01 15 nmol

Mouse PKD1L2 siRNA

Ask
View Details
Mouse PKD1L2 siRNA
abx928716-02 30 nmol

Mouse PKD1L2 siRNA

Ask
View Details
NR2F6 antibody - N-terminal region
MBS3207832-01 0.1 mL

NR2F6 antibody - N-terminal region

Ask
View Details
NR2F6 antibody - N-terminal region
MBS3207832-02 5x 0.1 mL

NR2F6 antibody - N-terminal region

Ask
View Details
SERPINB6 Antibody
MBS5312472-01 0.1 mL

SERPINB6 Antibody

Ask
View Details