Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B (C-6His)

Source: Human Cells. MW :14.37kD. Recombinant Human Activin Receptor IIB is produced by our Mammalian expression system and the target gene encoding Ser19-Thr134 is expressed with a 6His tag at the C-terminus. Activin proteins that belong to the transforming growth factor-beta (TGF- beta) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Product Specifications

Gene Name

ACVR2B

Gene ID

93

UniProt

Q13705

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hes2 sgRNA CRISPR Lentivector set (Mouse)
K3720001 3x 1.0 µg

Hes2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-208a-3p Vector
mm30333 500 ng

LentimiRa-Off-mmu-miR-208a-3p Vector

Sign In for Pricing
View Details
Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit
MBS7259007-01 48 Well

Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit

Sign In for Pricing
View Details
Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit
MBS7259007-02 96 Well

Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit

Sign In for Pricing
View Details
Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit
MBS7259007-03 5x 96 Well

Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit

Sign In for Pricing
View Details
Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit
MBS7259007-04 10x 96 Well

Goat Mitochondrial Import Receptor Subunit TOM40B (TOMM40L) ELISA Kit

Sign In for Pricing
View Details