Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B (C-6His)

Source: Human Cells. MW :14.37kD. Recombinant Human Activin Receptor IIB is produced by our Mammalian expression system and the target gene encoding Ser19-Thr134 is expressed with a 6His tag at the C-terminus. Activin proteins that belong to the transforming growth factor-beta (TGF- beta) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Product Specifications

Gene Name

ACVR2B

Gene ID

93

UniProt

Q13705

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

2,6-Diaminopyridine
270655-01 250 g

2,6-Diaminopyridine

Ask
View Details
2,6-Diaminopyridine
270655-02 500 g

2,6-Diaminopyridine

Ask
View Details
2,6-Diaminopyridine
270655-03 1 Kg

2,6-Diaminopyridine

Ask
View Details
Cdc16 (NM_027276) Mouse Tagged ORF Clone Lentiviral Particle
MR209493L3V 200 µL

Cdc16 (NM_027276) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
F7 Antibody
E30AC568 100 µL

F7 Antibody

Ask
View Details
hsa-miR-448 miRNA Antagomir
MBS8316152-01 10 nmol

hsa-miR-448 miRNA Antagomir

Ask
View Details