Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta C Chain/INHBC (N-6His)

Source: E.coli. MW :14.83kD. Recombinant Human Inhibin beta C Chain is produced by our E.coli expression system and the target gene encoding Gly237-Ser352 is expressed with a 6His tag at the N-terminus. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins, Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland.

Product Specifications

Gene Name

INHBC

Gene ID

3626

UniProt

P55103

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl, 1mM DTT.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Oosp3 shRNA (UAS) - Lentiviral mouse Oosp3 shRNA (UAS, GFP) (100)
GTR15147741 1 Vial

Lentiviral mouse Oosp3 shRNA (UAS) - Lentiviral mouse Oosp3 shRNA (UAS, GFP) (100)

Ask
View Details
4a-Des (methylcarboxy), 4a (S) -carboxyethyl Indoxacarb
434055-01 1 mg

4a-Des (methylcarboxy), 4a (S) -carboxyethyl Indoxacarb

Ask
View Details
4a-Des (methylcarboxy), 4a (S) -carboxyethyl Indoxacarb
434055-02 2.5 mg

4a-Des (methylcarboxy), 4a (S) -carboxyethyl Indoxacarb

Ask
View Details
Contactin 3 (CNTN3) Human Gene Knockout Kit (CRISPR)
KN421979 1 Kit

Contactin 3 (CNTN3) Human Gene Knockout Kit (CRISPR)

Ask
View Details
RPL21P26-set siRNA/shRNA/RNAi Lentivector (Human)
41027091 4x 500 ng

RPL21P26-set siRNA/shRNA/RNAi Lentivector (Human)

Ask
View Details
Cocaine test in urine
C8202 40 Tests

Cocaine test in urine

Ask
View Details