Recombinant Human Inhibin beta C Chain/INHBC (N-6His)
Source: E.coli. MW :14.83kD. Recombinant Human Inhibin beta C Chain is produced by our E.coli expression system and the target gene encoding Gly237-Ser352 is expressed with a 6His tag at the N-terminus. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins, Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland.
Product Specifications
Gene Name
INHBC
Gene ID
3626
UniProt
P55103
Components
Lyophilized from a 0.2 μm filtered solution of 4mM HCl, 1mM DTT.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGSSHHHHHHSSGLVPRGSHMGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog