Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2

Source: E.coli. MW :36.74kD. Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed. Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) plays a role in concert with the 5-a/5- beta-Steroid Reductases to convert Steroid hormones into the 3-a/5-a and 3-a/5- beta-Tetrahydrosteroids. AKR1C2 catalyzes the inactivation of the most potent androgen 5-a-Dihydrotestosterone (5-a-DHT) to 5-a-Androstane-3-a, 17- beta-diol (3-a-diol) .

Product Specifications

Gene Name

AKR1C2

Gene ID

1646

UniProt

P52895

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: LBI7A3]
AMM17252VCF 100 µg

Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: LBI7A3]

Ask
View Details
XYLB, NT (XYLB, Xylulose kinase) (MaxLight 490) discontinued
043940-ML490 100 µL

XYLB, NT (XYLB, Xylulose kinase) (MaxLight 490) discontinued

Ask
View Details
(N-alpha-Fmoc-O-beta- (2-acetamido-2-deoxy-3,4,6-tri-O-acetyl-alpha-D-galactopyranosyl) -L-threonine)
sc-295660A 100 mg

(N-alpha-Fmoc-O-beta- (2-acetamido-2-deoxy-3,4,6-tri-O-acetyl-alpha-D-galactopyranosyl) -L-threonine)

Ask
View Details