Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2

Source: E.coli. MW :36.74kD. Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed. Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) plays a role in concert with the 5-a/5- beta-Steroid Reductases to convert Steroid hormones into the 3-a/5-a and 3-a/5- beta-Tetrahydrosteroids. AKR1C2 catalyzes the inactivation of the most potent androgen 5-a-Dihydrotestosterone (5-a-DHT) to 5-a-Androstane-3-a, 17- beta-diol (3-a-diol) .

Product Specifications

Gene Name

AKR1C2

Gene ID

1646

UniProt

P52895

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Desmin Antibody
CPA9683-01 30 µL

Anti-Desmin Antibody

Ask
View Details
Anti-Desmin Antibody
CPA9683-02 50 μL

Anti-Desmin Antibody

Ask
View Details
Anti-Desmin Antibody
CPA9683-03 100 µL

Anti-Desmin Antibody

Ask
View Details
Anti-Desmin Antibody
CPA9683-04 200 µL

Anti-Desmin Antibody

Ask
View Details
Recombinant Mouse NgR3/NgRH2 CF
8426-NG-050 50 µg

Recombinant Mouse NgR3/NgRH2 CF

Ask
View Details
Human GZMM (Granzyme M) ELISA Kit
EH25525 96 Tests

Human GZMM (Granzyme M) ELISA Kit

Ask
View Details