Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HGPRT/HPRT1 (N-6His)

Source: E.coli. MW :27.79kD. Recombinant Human HGPRT is produced by our E.coli expression system and the target gene encoding Met1-Ala218 is expressed with a 6His tag at the N-terminus. Hypoxanthine-Guanine Phosphoribosyltransferase (HGPRT) has an important role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 functions to salvage purines from degraded DNA to renewed purine synthesis, it acts as a catalyst in the reaction between guanine and phosphoribosyl pyrophosphate to form GMP.

Product Specifications

Gene Name

HPRT1

Gene ID

3251

UniProt

P00492

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 2mM EDTA, 30% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKAVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Olfactory receptor 1N1 antibody
STJ94651 200 µl

Anti-Olfactory receptor 1N1 antibody

Ask
View Details
Dusp1 (NM_013642) Mouse Tagged Lenti ORF Clone
MR205652L3 10 µg

Dusp1 (NM_013642) Mouse Tagged Lenti ORF Clone

Ask
View Details
Cavy Kelch-Like Protein 34 (KLHL34) ELISA Kit
MBS9907449 Inquire

Cavy Kelch-Like Protein 34 (KLHL34) ELISA Kit

Ask
View Details
Human Calnexin (CNX) ELISA Kit
MBS454833-01 48 Tests

Human Calnexin (CNX) ELISA Kit

Ask
View Details
Human Calnexin (CNX) ELISA Kit
MBS454833-02 96 Tests

Human Calnexin (CNX) ELISA Kit

Ask
View Details
Human Calnexin (CNX) ELISA Kit
MBS454833-03 5x 96 Tests

Human Calnexin (CNX) ELISA Kit

Ask
View Details