Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HGPRT/HPRT1 (N-6His)

Source: E.coli. MW :27.79kD. Recombinant Human HGPRT is produced by our E.coli expression system and the target gene encoding Met1-Ala218 is expressed with a 6His tag at the N-terminus. Hypoxanthine-Guanine Phosphoribosyltransferase (HGPRT) has an important role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 functions to salvage purines from degraded DNA to renewed purine synthesis, it acts as a catalyst in the reaction between guanine and phosphoribosyl pyrophosphate to form GMP.

Product Specifications

Gene Name

HPRT1

Gene ID

3251

UniProt

P00492

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 2mM EDTA, 30% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKAVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-SerpinB3 Antibody, Mouse Monoclonal
MBS8106840-01 0.1 mL

Anti-SerpinB3 Antibody, Mouse Monoclonal

Ask
View Details
Anti-SerpinB3 Antibody, Mouse Monoclonal
MBS8106840-02 5x 0.1 mL

Anti-SerpinB3 Antibody, Mouse Monoclonal

Ask
View Details
LRPAP1 Antibody
MBS9607792-01 0.1 mL

LRPAP1 Antibody

Ask
View Details
LRPAP1 Antibody
MBS9607792-02 0.2 mL

LRPAP1 Antibody

Ask
View Details
LRPAP1 Antibody
MBS9607792-03 5x 0.2 mL

LRPAP1 Antibody

Ask
View Details
Rabbit anti-Escherichia coli O157:H7 YAHH Polyclonal Antibody
MBS9005197 Inquire

Rabbit anti-Escherichia coli O157:H7 YAHH Polyclonal Antibody

Ask
View Details