Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ethanolaminephosphotransferase 1/EPT1 (N-GST)

Source: E.coli. MW :32.3kD. Recombinant Human EPT1 is produced by our E.coli expression system and the target gene encoding Met1-Pro50 is expressed with a GST tag at the N-terminus. Ethanolaminephosphotransferase 1 (EPT1) is an enzyme that belongs to the CDP-Alcohol Phosphatidyltransferase Class-I Family. EPT1 is a Selenoprotein, which contains a Selenocysteine (Sec) residue at its active site. The Selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of Selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. EPT1 catalyzes Phosphatidylethanolamine biosynthesis from CDP-Ethanolamine. It plays a central role in the formation and maintenance of vesicular membranes. EPT1 is involved in the formation of Phosphatidylethanolamine via the 'Kennedy' pathway.

Product Specifications

Gene Name

SELENOI

Gene ID

85465

UniProt

Q9C0D9

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tensin-3 (TNS3, Tensin-like SH2 Domain-containing Protein 1, Tumor Endothelial Marker 6, TEM6, TENS1, TPP) (MaxLight 650)
MBS6270174-01 0.1 mL

Tensin-3 (TNS3, Tensin-like SH2 Domain-containing Protein 1, Tumor Endothelial Marker 6, TEM6, TENS1, TPP) (MaxLight 650)

Ask
View Details
Tensin-3 (TNS3, Tensin-like SH2 Domain-containing Protein 1, Tumor Endothelial Marker 6, TEM6, TENS1, TPP) (MaxLight 650)
MBS6270174-02 5x 0.1 mL

Tensin-3 (TNS3, Tensin-like SH2 Domain-containing Protein 1, Tumor Endothelial Marker 6, TEM6, TENS1, TPP) (MaxLight 650)

Ask
View Details
TCF12 (NM_207038) Human Tagged Lenti ORF Clone
RC220246L3 10 µg

TCF12 (NM_207038) Human Tagged Lenti ORF Clone

Ask
View Details
Progesterone Receptor antibody
MBS5309503-01 0.05 mg

Progesterone Receptor antibody

Ask
View Details
Progesterone Receptor antibody
MBS5309503-02 5x 0.05 mg

Progesterone Receptor antibody

Ask
View Details
OR6P1 Antibody
MBS855554-01 0.1 mg

OR6P1 Antibody

Ask
View Details