Recombinant Human Z-DNA Binding Protein 1/ZBP1 (C-6His)

Source: E.coli. MW :17.5kD. Recombinant Human Z-DNA Binding Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Ser149 is expressed with a 6His tag at the C-terminus. Z-DNA Binding Protein 1 (ZBP1) is a protein with 2 DRADA repeats. ZBP1 is highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow, and spleen. ZBP1 participates in the detection of viral and bacterial DNA from by the host's innate immune system. It plays a role in host defense against tumors and pathogens. ZBP1 Acts as a cytoplasmic DNA sensor which, when activated, induces the recruitment of TBK1 and IRF3 to its C-terminal region and activates the downstream interferon regulatory factor (IRF) and NF-kappa B transcription factors, leading to type-I interferon production. ZBP1-induced NF-kappaB activation probably involves the recruitment of the RHIM containing kinases RIPK1 and RIPK3.

Product Specifications

Gene Name

ZBP1

Gene ID

81030

UniProt

Q9H171

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSVDHHHHHH