Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galactose Mutarotase/GALM (C-6His)

Source: E.coli. MW :38.8kD. Recombinant Human Galactose Mutarotase is produced by our E.coli expression system and the target gene encoding Ala2-Ala342 is expressed with a 6His tag at the C-terminus. Galactose Mutarotase (GALM) is a cytoplasmic enzyme that belongs to the Aldose Epimerase family. GALM is a Mutarotase that converts a-Aldose to the beta-Anomer. GALM is active on D-Glucose, L-Arabinose, D-Xylose, D-Galactose, Maltose and Lactose. GALM may be required for normal Galactose metabolism by maintaining the equilibrium of a- and beta- anomers of Galactose.

Product Specifications

Gene Name

GALM

Gene ID

130589

UniProt

Q96C23

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVALEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF568 conjugate, 0.1mg/mL
BNC682398-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2398), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details