Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galactose Mutarotase/GALM (C-6His)

Source: E.coli. MW :38.8kD. Recombinant Human Galactose Mutarotase is produced by our E.coli expression system and the target gene encoding Ala2-Ala342 is expressed with a 6His tag at the C-terminus. Galactose Mutarotase (GALM) is a cytoplasmic enzyme that belongs to the Aldose Epimerase family. GALM is a Mutarotase that converts a-Aldose to the beta-Anomer. GALM is active on D-Glucose, L-Arabinose, D-Xylose, D-Galactose, Maltose and Lactose. GALM may be required for normal Galactose metabolism by maintaining the equilibrium of a- and beta- anomers of Galactose.

Product Specifications

Gene Name

GALM

Gene ID

130589

UniProt

Q96C23

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVALEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)
MBS1143713-01 0.02 mg (E-Coli)

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)

Ask
View Details
Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)
MBS1143713-02 0.02 mg (Yeast)

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)

Ask
View Details
Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)
MBS1143713-03 0.1 mg (E-Coli)

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)

Ask
View Details
Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)
MBS1143713-04 0.1 mg (Yeast)

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)

Ask
View Details
Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)
MBS1143713-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)

Ask
View Details
Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)
MBS1143713-06 0.02 mg (Mammalian-Cell)

Recombinant Mycobacterium ulcerans 2-phospho-L-lactate transferase (cofD)

Ask
View Details