Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HDHD2 (N-6His)

Source: E.coli. MW :30.7kD. Recombinant Human HDHD2 is produced by our E.coli expression system and the target gene encoding Met1-Leu259 is expressed with a 6His tag at the N-terminus. Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 22 (HDHD2) is a member of the HAD-like hydrolase superfamily. HDHD2 includes L-2-Haloacid Dehalogenase, Epoxide Hydrolases and Phosphatases. There are two active sites in HDHD2 - an L-2-Haloacid Dehalogenase and a Carboxylate group. The L-2-Haloacid Dehalogenase active site catalyzes the hydrolytic dehalogenation of D- and L-2-Haloalkanoic Acids, producing L- and D-2-Hydroxyalkanoic Acids.

Product Specifications

Gene Name

HDHD2

Gene ID

84064

UniProt

Q9H0R4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLV3-CMV-X (HBV) -3xFLAG-CopGFP-Puro Plasmid
PVT85323 2 µg

PLV3-CMV-X (HBV) -3xFLAG-CopGFP-Puro Plasmid

Ask
View Details
BNIPL (Bcl-2/Adenovirus E1B 19kD-interacting Protein 2-like Protein, BNIPl-1, BNIPL-1, BNIPL-2, BNIP-S, PP753) (APC)
123976-APC 100 µL

BNIPL (Bcl-2/Adenovirus E1B 19kD-interacting Protein 2-like Protein, BNIPl-1, BNIPL-1, BNIPL-2, BNIP-S, PP753) (APC)

Ask
View Details
N-Hydroxy-L-pipecolic Acid Sodium Salt (~90%)
TRC-H702015-10MG 10 mg

N-Hydroxy-L-pipecolic Acid Sodium Salt (~90%)

Ask
View Details
Lentiviral human DTX1 shRNA (UAS) - Lentiviral human DTX1 shRNA (UAS) (100)
GTR15095118 1 Vial

Lentiviral human DTX1 shRNA (UAS) - Lentiviral human DTX1 shRNA (UAS) (100)

Ask
View Details
Cramp1l (NM_020608) Mouse Tagged Lenti ORF Clone
MR217849L3 10 µg

Cramp1l (NM_020608) Mouse Tagged Lenti ORF Clone

Ask
View Details