Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uroporphyrinogen Decarboxylase/UROD (N-6His)

Source: E.coli. MW :43kD. Recombinant Human Uroporphyrinogen Decarboxylase is produced by our E.coli expression system and the target gene encoding Met1-Asn367 is expressed with a 6His tag at the N-terminus. Uroporphyrinogen decarboxylase (UROD), is an enzyme of the heme biosynthetic pathway which belongs to the uroporphyrinogen decarboxylase family. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. UROD is a homodimeric enzyme that catalyzes the fifth step in heme biosynthesis: the elimination of carboxyl groups from the four acetate side chains of uroporphyrinogen III to yield coproporphyrinogen III. Defects in UROD are the cause of familial porphyria cutanea tarda (FPCT) and hepatoerythropoietic porphyria (HEP) .

Product Specifications

Gene Name

UROD

Gene ID

7389

UniProt

P06132

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 1mM EDTA, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human TNNI3 Protein, Untagged, E.coli-50ug
QP13777-50ug 50ug

Recombinant Human TNNI3 Protein, Untagged, E.coli-50ug

Ask
View Details
Recombinant Human DAN domain family member 5 Protein, His-SUMO, E.coli-50ug
QP7970-ec-50ug 50ug

Recombinant Human DAN domain family member 5 Protein, His-SUMO, E.coli-50ug

Ask
View Details
Human PSMB10/MECL1 Affinity Purified Polyclonal Ab
AF7684 100 µg

Human PSMB10/MECL1 Affinity Purified Polyclonal Ab

Ask
View Details
Human RBP1 knockout cell line
ABC-KH12771 1 Vial

Human RBP1 knockout cell line

Ask
View Details