Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apoptosis-Inducing Factor 1 Mitochondrial/AIFM1 (N-6His)

Source: E.coli. MW :56.2kD. Recombinant Human Apoptosis-Inducing Factor 1 is produced by our E.coli expression system and the target gene encoding Glu121-Asp613 is expressed with a 6His tag at the N-terminus. Apoptosis-Inducing Factor 1, Mitochondrial (AIFM1) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. During apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces parthanatos i.e., caspase-independent fragmentation of chromosomal DNA. AIFM1 interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. It binds to DNA in a sequence-independent manner and plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells.

Product Specifications

Gene Name

AIFM1

Gene ID

9131

UniProt

O95831

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GAK Antibody, Biotin conjugated
A22720-100UG 100 µg

GAK Antibody, Biotin conjugated

Ask
View Details
Rat 26S proteasome (26S PSM) ELISA Kit
GA-E0034RT-01 48 Tests

Rat 26S proteasome (26S PSM) ELISA Kit

Ask
View Details
Rat 26S proteasome (26S PSM) ELISA Kit
GA-E0034RT-02 96 Tests

Rat 26S proteasome (26S PSM) ELISA Kit

Ask
View Details
Mmu-miR-488-5p miRNA Inhibitor
CIM0266-01 10 nmol

Mmu-miR-488-5p miRNA Inhibitor

Ask
View Details
Mmu-miR-488-5p miRNA Inhibitor
CIM0266-02 20 nmol

Mmu-miR-488-5p miRNA Inhibitor

Ask
View Details
Ajap1 (NM_001099299) Mouse Tagged ORF Clone Lentiviral Particle
MR219007L4V 200 µL

Ajap1 (NM_001099299) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details