Recombinant Human DCN1-Like Protein 1/DCUN1D1 (N-6His)

Source: E.coli. MW :32.3kD. Recombinant Human DCN1-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Val259 is expressed with a 6His tag at the N-terminus. DCN1-Like Protein 1 is a protein containing 1 DCUN1 domain and 1 UBA-like domain. DCN1-Like Protein 1 contains part of an E3 Ubiquitin Ligase Complex for Neddylation. It is required for Neddylation of Cullin components of E3 Cullin-RING Ubiquitin Ligase complexes. It enhances the rate of Cullins Neddylation. DCN1-Like Protein 1 recruits the NEDD8-charged E2 Enzyme to the Cullin component. DCUN1D1 is involved in the release of inhibitory effects of CAND1 on the Cullin-RING Ligase E3 complex assembly and activity. It acts also as an oncogene facilitating malignant transformation and carcinogenic progression.

Product Specifications

Gene Name

DCUN1D1

Gene ID

54165

UniProt

Q96GG9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV