Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chloride Intracellular Channel Protein 2/CLIC2 (N-6His)

Source: E.coli. MW :30.5kD. Recombinant Human CLIC2 is produced by our E.coli expression system and the target gene encoding Met1-Ser247 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 2 (CLIC2) is a critical component of all living cells; it regulatescellular traffic of Chloride ion and it can be inserted into membranes anf form chloride ion channels. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions, channel activity depends on the pH. CLIC2 is involved in regulating membrane potential and organic solute transport. CLIC2 modulates the activity of RYR2 and inhibits Calcium influx. CLIC2 can be detected in the adult brain, liver, lung, heart, stomach, spleen and testis. It is expressed in fetal liver and adult skeletal muscle. CLIC2 is a potential candidate for one of many diseases linked to Xq28.

Product Specifications

Gene Name

CLIC2

Gene ID

1193

UniProt

O15247

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-NF-κB p105/p50 (Rabbit, Polyclonal, IgG)
A117207 100 µL

Anti-NF-κB p105/p50 (Rabbit, Polyclonal, IgG)

Ask
View Details
Human C1orf204 knockdown cell line
ABC-KD1899 1 Vial

Human C1orf204 knockdown cell line

Ask
View Details
α-Glucosidase-IN-85
MF-0114333-01 10 mg

α-Glucosidase-IN-85

Ask
View Details
α-Glucosidase-IN-85
MF-0114333-02 50 mg

α-Glucosidase-IN-85

Ask
View Details
Rabbit Monoclonal EphA6 Antibody (033) [DyLight 594]
NBP2-90658DL594 0.1 mL

Rabbit Monoclonal EphA6 Antibody (033) [DyLight 594]

Ask
View Details
Recombinant Polynucleobacter sp. ATP synthase subunit delta (atpH)
MBS1000831-01 0.02 mg (E-Coli)

Recombinant Polynucleobacter sp. ATP synthase subunit delta (atpH)

Ask
View Details