Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UDP-Glucose 4-Epimerase/GALE (N-6His)

Source: E.coli. MW :40.44kD. Recombinant Human GALE is produced by our E.coli expression system and the target gene encoding Met1-Ala348 is expressed with a 6His tag at the N-terminus. The enzyme UDP-Glucose 4-Epimerase (GALE) is a homodimeric epimerase found in bacterial, plant and mammalian cells. UDP-Glucose 4-Epimerase performs the final step in the Leloir pathway of Galactose metabolism, it catalyzes two distinct but analogous reactions: the epimerization of UDP-Gglucose to UDP-Galactose and the epimerization of UDP-N-Acetylglucosamine to UDP-N-Acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids.

Product Specifications

Gene Name

GALE

Gene ID

2582

UniProt

Q14376

Components

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 2mM DTT, 1mM EDTA, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IST1 Antibody
CQA4800-01 30 µL

Anti-IST1 Antibody

Sign In for Pricing
View Details
Anti-IST1 Antibody
CQA4800-02 50 μL

Anti-IST1 Antibody

Sign In for Pricing
View Details
Anti-IST1 Antibody
CQA4800-03 100 µL

Anti-IST1 Antibody

Sign In for Pricing
View Details
Anti-IST1 Antibody
CQA4800-04 200 µL

Anti-IST1 Antibody

Sign In for Pricing
View Details
WDR81 Rabbit pAb
A12780-01 20 µL

WDR81 Rabbit pAb

Sign In for Pricing
View Details
WDR81 Rabbit pAb
A12780-02 1000 μL

WDR81 Rabbit pAb

Sign In for Pricing
View Details