Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UDP-Glucose 4-Epimerase/GALE (N-6His)

Source: E.coli. MW :40.44kD. Recombinant Human GALE is produced by our E.coli expression system and the target gene encoding Met1-Ala348 is expressed with a 6His tag at the N-terminus. The enzyme UDP-Glucose 4-Epimerase (GALE) is a homodimeric epimerase found in bacterial, plant and mammalian cells. UDP-Glucose 4-Epimerase performs the final step in the Leloir pathway of Galactose metabolism, it catalyzes two distinct but analogous reactions: the epimerization of UDP-Gglucose to UDP-Galactose and the epimerization of UDP-N-Acetylglucosamine to UDP-N-Acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids.

Product Specifications

Gene Name

GALE

Gene ID

2582

UniProt

Q14376

Components

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 2mM DTT, 1mM EDTA, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-MARCO Rabbit pAb
GB114239-100 100 μL

Anti-MARCO Rabbit pAb

Ask
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
ELK6852-01 48 Tests

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Ask
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
ELK6852-02 96 Tests

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Ask
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
ELK6852-03 5x 96 Tests

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Ask
View Details
Anti-MMP24
Y058473 100 µL

Anti-MMP24

Ask
View Details
BROX Rabbit Polyclonal Antibody
TA358425 100 µL

BROX Rabbit Polyclonal Antibody

Ask
View Details