Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm1/LSM1 (C-6His)

Source: E.coli. MW :16.23kD. Recombinant Human LSM1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr133 is expressed with a 6His tag at the C-terminus. U6 snRNA-Associated Sm-Like Protein LSm1 (LSM1) belongs to the snRNP Sm proteins family. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which plays an important role in pre-mRNA splicing. LSM1 binds specifically to the 3-terminal U-tract of U6snRNA. LSM1 can interact with SLBP when histone mRNA is being rapidly degraded during the S phase. In addition, LSM1 is associated with cellular transformation and the progression of several malignancies including mesothelioma, lung cancer and breast cancer.

Product Specifications

Gene Name

LSM1

Gene ID

27257

UniProt

O15116

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYVEHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C12]
TA809537BM 100 µL

TRMT12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C12]

Sign In for Pricing
View Details
2- (Cyclopropylmethoxy) -acetic Acid 1,1-Dimethyl-2-[4- (methylsulfonyl) phenyl]-2-oxoethyl Ester
007364 1 mg

2- (Cyclopropylmethoxy) -acetic Acid 1,1-Dimethyl-2-[4- (methylsulfonyl) phenyl]-2-oxoethyl Ester

Sign In for Pricing
View Details
Human Histone-Lysine N-Methyltransferase EHMT2 (EHMT2) ELISA Kit
YLA4701HU-01 48 Tests

Human Histone-Lysine N-Methyltransferase EHMT2 (EHMT2) ELISA Kit

Sign In for Pricing
View Details
Human Histone-Lysine N-Methyltransferase EHMT2 (EHMT2) ELISA Kit
YLA4701HU-02 96 Tests

Human Histone-Lysine N-Methyltransferase EHMT2 (EHMT2) ELISA Kit

Sign In for Pricing
View Details
Human BAFF (BLyS), (Recombinant)
22060254-1 5 μg

Human BAFF (BLyS), (Recombinant)

Sign In for Pricing
View Details
Potassium Hydroxide (0.1N) in Ethanol
40220127-1 500 mL

Potassium Hydroxide (0.1N) in Ethanol

Sign In for Pricing
View Details