Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm1/LSM1 (C-6His)
Source: E.coli. MW :16.23kD. Recombinant Human LSM1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr133 is expressed with a 6His tag at the C-terminus. U6 snRNA-Associated Sm-Like Protein LSm1 (LSM1) belongs to the snRNP Sm proteins family. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which plays an important role in pre-mRNA splicing. LSM1 binds specifically to the 3-terminal U-tract of U6snRNA. LSM1 can interact with SLBP when histone mRNA is being rapidly degraded during the S phase. In addition, LSM1 is associated with cellular transformation and the progression of several malignancies including mesothelioma, lung cancer and breast cancer.
Product Specifications
Gene Name
LSM1
Gene ID
27257
UniProt
O15116
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYVEHHHHHH
Explore Other Products
Browse additional items from our catalog