Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SCO1 Homolog Mitochondrial SCO1/SCOD1 (N-GST)

Source: E.coli. MW :20.14kD. Recombinant Human Protein SCO1 Homolog Mitochondrial is produced by our E.coli expression system and the target gene encoding Gly132-Ser300 is expressed with a GST tag at the N-terminus. Protein SCO1 Homolog, Mitochondrial (SCO1) is a member of the SCO1/2 family. SCO1 has a homodimer structure. SCO1 is located in mitochondrion and is highly expressed in muscle, heart, and brain. It is characterized by high rates of Oxidative Phosphorylation (OxPhos) . SCO1 is thought to play a important role in cellular copper homeostasis, mitochondrial redox signaling and insertion of copper into the active site of COX. The defects of SCO1 can result in Mitochondrial Complex IV Deficiency (MT-C4D) . A disorder of the mitochondrial respiratory chain has heterogeneous clinical manifestations, ranging from isolated myopathy to severe multisystem disease affecting several tissues and organs.

Product Specifications

Gene Name

SCO1

Gene ID

6341

UniProt

O75880

Components

Lyophilized from a 0.2 μm filtered solution of 50mM PB, 1mM DTT, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSPEFHMGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BU-1) [DyLight 350]
FAB7225D 0.1 mL

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BU-1) [DyLight 350]

Sign In for Pricing
View Details
Anti-GALR1 Antibody
MBS8240326-01 0.03 mL

Anti-GALR1 Antibody

Sign In for Pricing
View Details
Anti-GALR1 Antibody
MBS8240326-02 0.05 mL

Anti-GALR1 Antibody

Sign In for Pricing
View Details
Anti-GALR1 Antibody
MBS8240326-03 0.1 mL

Anti-GALR1 Antibody

Sign In for Pricing
View Details
Anti-GALR1 Antibody
MBS8240326-04 0.2 mL

Anti-GALR1 Antibody

Sign In for Pricing
View Details
Anti-GALR1 Antibody
MBS8240326-05 5x 0.2 mL

Anti-GALR1 Antibody

Sign In for Pricing
View Details