Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein P/S100-P (N-6His)

Source: E.coli. MW :12.56kD. Recombinant Human S100 Calcium Binding Protein P is produced by our E.coli expression system and the target gene encoding Met1-Lys95 is expressed with a 6His tag at the N-terminus. Protein S100-P (S100P) belongs to the S100 family of Calcium-Binding Proteins. S100P is 95 amino acids in length and it contains 2 EF-Hand Calcium-Binding Motifs. The EF-Hand Motif binds calcium, which likely alters molecular conformation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells and it is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. In addition to binding Ca, S100P also binds Zn and Mg, and may play a role in the etiology of prostate cancer.

Product Specifications

Gene Name

S100P

Gene ID

6286

UniProt

P25815

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 0.1M NaCl, 20% Glycerol, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DCTD shRNA (UAS) - Lentiviral human DCTD shRNA (UAS, GFP) plasmid
GTR15139126 1 Vial

Lentiviral human DCTD shRNA (UAS) - Lentiviral human DCTD shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IFFO1 Recombinant Protein (Human)
RP039961 100 µg

IFFO1 Recombinant Protein (Human)

Sign In for Pricing
View Details
NEIL3 discontinued
392090 200 µL

NEIL3 discontinued

Sign In for Pricing
View Details
G protein-activated inward rectifier potassium channel 2 (KCNJ6) Human ELISA Kit
D5471 96 Tests

G protein-activated inward rectifier potassium channel 2 (KCNJ6) Human ELISA Kit

Sign In for Pricing
View Details
CHCHD7 (NM_024300) Human Over-expression Lysate
LH11957V 100 µg

CHCHD7 (NM_024300) Human Over-expression Lysate

Sign In for Pricing
View Details
MTR4 Antibody
ABD7409 100 µg

MTR4 Antibody

Sign In for Pricing
View Details