Recombinant Human S100 Calcium Binding Protein P/S100-P (N-6His)
Source: E.coli. MW :12.56kD. Recombinant Human S100 Calcium Binding Protein P is produced by our E.coli expression system and the target gene encoding Met1-Lys95 is expressed with a 6His tag at the N-terminus. Protein S100-P (S100P) belongs to the S100 family of Calcium-Binding Proteins. S100P is 95 amino acids in length and it contains 2 EF-Hand Calcium-Binding Motifs. The EF-Hand Motif binds calcium, which likely alters molecular conformation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells and it is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. In addition to binding Ca, S100P also binds Zn and Mg, and may play a role in the etiology of prostate cancer.
Product Specifications
Gene Name
S100P
Gene ID
6286
UniProt
P25815
Components
Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 0.1M NaCl, 20% Glycerol, pH 8.0 .
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items