Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein P/S100-P (N-6His)

Source: E.coli. MW :12.56kD. Recombinant Human S100 Calcium Binding Protein P is produced by our E.coli expression system and the target gene encoding Met1-Lys95 is expressed with a 6His tag at the N-terminus. Protein S100-P (S100P) belongs to the S100 family of Calcium-Binding Proteins. S100P is 95 amino acids in length and it contains 2 EF-Hand Calcium-Binding Motifs. The EF-Hand Motif binds calcium, which likely alters molecular conformation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells and it is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. In addition to binding Ca, S100P also binds Zn and Mg, and may play a role in the etiology of prostate cancer.

Product Specifications

Gene Name

S100P

Gene ID

6286

UniProt

P25815

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 0.1M NaCl, 20% Glycerol, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human ZCCHC4 qPCR Primer Pair
QH39101S 200 Tests

Human ZCCHC4 qPCR Primer Pair

Ask
View Details
Glucose Pentasulfate, Potassium Salt
sc-280740 25 mg

Glucose Pentasulfate, Potassium Salt

Ask
View Details
Lentiviral human ERVV-1 shRNA (UAS) - Lentiviral human ERVV-1 shRNA (UAS, GFP) plasmid
GTR15111718 1 Vial

Lentiviral human ERVV-1 shRNA (UAS) - Lentiviral human ERVV-1 shRNA (UAS, GFP) plasmid

Ask
View Details
Dusp26 Mouse siRNA Oligo Duplex (Locus ID 66959)
SR405546 1 Kit

Dusp26 Mouse siRNA Oligo Duplex (Locus ID 66959)

Ask
View Details
Axitinib-13C, d3
HY-10065S-01 1 mg

Axitinib-13C, d3

Ask
View Details
Axitinib-13C, d3
HY-10065S-02 5 mg

Axitinib-13C, d3

Ask
View Details