Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CutA (C-6His)

Source: E.coli. MW :17.9kD. Recombinant Human Protein CutA is produced by our E.coli expression system and the target gene encoding Met1-Pro156 is expressed with a 6His tag at the C-terminus. Protein CutA (CUTA) posseses a signal peptide and is widely expressed in brain. CUTA mayforms part of a complex of membrane proteins attached to acetylcholinesterase (AChE) . CUTA takes part in cellular tolerance to a broad range of divalent cations other than copper. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found.

Product Specifications

Gene Name

CUTA

Gene ID

51596

UniProt

O60888

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Svep1-set siRNA/shRNA/RNAi Lentivector (Mouse)
45924094 4x 500 ng

Svep1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details
Mouse Monoclonal HLA DQ Antibody (TAL 4.1) [DyLight 650]
NB100-2700C 0.1 mL

Mouse Monoclonal HLA DQ Antibody (TAL 4.1) [DyLight 650]

Ask
View Details
FDCSP Adenovirus (Human)
20416051 1.0 mL

FDCSP Adenovirus (Human)

Ask
View Details
P2X1, Antiserum, Rabbit
MBS555578-01 0.05 mL

P2X1, Antiserum, Rabbit

Ask
View Details
P2X1, Antiserum, Rabbit
MBS555578-02 0.15 mL

P2X1, Antiserum, Rabbit

Ask
View Details
P2X1, Antiserum, Rabbit
MBS555578-03 5x 0.15 mL

P2X1, Antiserum, Rabbit

Ask
View Details