Recombinant Human Protein CutA (C-6His)
Source: E.coli. MW :17.9kD. Recombinant Human Protein CutA is produced by our E.coli expression system and the target gene encoding Met1-Pro156 is expressed with a 6His tag at the C-terminus. Protein CutA (CUTA) posseses a signal peptide and is widely expressed in brain. CUTA mayforms part of a complex of membrane proteins attached to acetylcholinesterase (AChE) . CUTA takes part in cellular tolerance to a broad range of divalent cations other than copper. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found.
Product Specifications
Gene Name
CUTA
Gene ID
51596
UniProt
O60888
Components
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SHC (SHC1) pTyr239/240 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 1E3]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb658/imageurl/am00141pu-n.webp)
AM00141PU-N 100 µg
SHC (SHC1) pTyr239/240 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 1E3]
Sign In for Pricing
View Details 
1310000-00-37.500MG 500 mg
Ɑ-Hydroxy-ω-Succinamic Boc Hydrazido PEG
Sign In for Pricing
View Details ![Bmi1 (COMMD3-BMI1) Mouse Monoclonal Antibody [Clone ID: 3E3]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbed3/imageurl/am06695su-n.webp)
AM06695SU-N 100 µL
Bmi1 (COMMD3-BMI1) Mouse Monoclonal Antibody [Clone ID: 3E3]
Sign In for Pricing
View Details 
BNUB2366-100 1x 100 µL
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), 0.2mg/mL
Sign In for Pricing
View Details