Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H/PPIH (N-6His)

Source: E.coli. MW :21.4kD. Recombinant Human PPIase H is produced by our E.coli expression system and the target gene encoding Met1-Met177 is expressed with a 6His tag at the N-terminus. Peptidyl-Prolyl Cis-Trans Isomerase H (PPIH) belongs to the Cyclophilin-type PPIase family that accelerate the folding of proteins. PPIases can catalyze the cis-trans isomerization of Proline Imidic peptide bonds in oligopeptides. PPIH participates in pre-mRNA splicing. It is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. In addition, PPIH has PPIase activity and may play a role as a chaperone mediating the interactions between different proteins inside the spliceosome.

Product Specifications

Gene Name

PPIH

Gene ID

10465

UniProt

O43447

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCR7 VersaClone cDNA
RDC0014 10 µg

Human CCR7 VersaClone cDNA

Sign In for Pricing
View Details
USP6NL  polyclonal antibody
BS76465 50ul

USP6NL polyclonal antibody

Sign In for Pricing
View Details
Human Fibroblast growth factor 5 ELISA Kit
MBS761390-01 48 Well

Human Fibroblast growth factor 5 ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast growth factor 5 ELISA Kit
MBS761390-02 96 Well

Human Fibroblast growth factor 5 ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast growth factor 5 ELISA Kit
MBS761390-03 5x 96 Well

Human Fibroblast growth factor 5 ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast growth factor 5 ELISA Kit
MBS761390-04 10x 96 Well

Human Fibroblast growth factor 5 ELISA Kit

Sign In for Pricing
View Details