Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat Shock Protein beta-11/HSPB11 (N-6His)

Source: E.coli. MW :18.5kD. Recombinant Human Heat Shock Protein beta-11 is produced by our E.coli expression system and the target gene encoding Met1-Ser144 is expressed with a 6His tag at the N-terminus. Heat Shock Protein beta-11 (HSPB11) is a stress-responsive protein that is required to deal with proteotoxic stresses. HSPB11 is composed of an IFT complex B composed of IFT88, IFT57, TRAF3IP1, IFT52, IFT27, HSPB11 and IFT20 and is detected in placenta. HSPB11 has beeb shown to form oligomeric complexes and prevent the aggregation of in vitro denaturated aldolase and glyceraldehyde-3-phosphate dehydrogenase in accordance with the chaperone model of HSPB1 and HSPB5. HSPB11 overexpression protected against etoposide-induced cell death that correlated with a decreased release of mitochondrial Cytochrome C into the cytosol. Inhibition of HSP90 function completely abrogated the protective effect of HSPB11. This data suggests that at least in the case of HSPB11, interaction with other chaperone machines besides HSPA1A may contribute to functional specificity and cellular functioning.

Product Specifications

Gene Name

HSPB11

Gene ID

51668

UniProt

Q9Y547

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FAM195B (MCRIP1) CytoSection
TS411513P5 25 Slides

FAM195B (MCRIP1) CytoSection

Ask
View Details
RBP1 (CRBP1) discontinued
513532 100 µg

RBP1 (CRBP1) discontinued

Ask
View Details
Magic™ Membrane Protein Human PCDHB5 (Protocadherin beta 5) for Antibody Discovery
MP0103Q Each

Magic™ Membrane Protein Human PCDHB5 (Protocadherin beta 5) for Antibody Discovery

Ask
View Details
Tropomodulin 1 (TMOD1, Erythrocyte Tropomodulin, E-Tmod) (MaxLight 750) discontinued
215192-ML750 100 µL

Tropomodulin 1 (TMOD1, Erythrocyte Tropomodulin, E-Tmod) (MaxLight 750) discontinued

Ask
View Details
Mouse Anti-Human IgG3 - PE
CSA4751-01 100 µL

Mouse Anti-Human IgG3 - PE

Ask
View Details
Mouse Anti-Human IgG3 - PE
CSA4751-02 500 μL

Mouse Anti-Human IgG3 - PE

Ask
View Details