Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphomannomutase 2/PMM2 (C-6His)

Source: E.coli. MW :29.1kD. Recombinant Human Phosphomannomutase 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser246 is expressed with a 6His tag at the C-terminus. Phosphomannomutase 2 (PMM2) is an enzyme that is a member of the highly variable methyltransferase superfamily. PMM2 is a cytoplasmic protein and catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate.In addition, PMM2 involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose that required for a number of critical mannosyl transfer reactions. Defects in PMM2 can results in congenital disorder of glycosylation type 1A (CDG1A) . Congenital disorders of glycosylation are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation.

Product Specifications

Gene Name

PMM2

Gene ID

5373

UniProt

O15305

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFSLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Melanocyte antibody ELISA Kit
MBS751209-01 48 Well

Bovine Melanocyte antibody ELISA Kit

Ask
View Details
Bovine Melanocyte antibody ELISA Kit
MBS751209-02 96 Well

Bovine Melanocyte antibody ELISA Kit

Ask
View Details
Bovine Melanocyte antibody ELISA Kit
MBS751209-03 5x 96 Well

Bovine Melanocyte antibody ELISA Kit

Ask
View Details
Bovine Melanocyte antibody ELISA Kit
MBS751209-04 10x 96 Well

Bovine Melanocyte antibody ELISA Kit

Ask
View Details
Sofosbuvir Impurity 8
RM-S060232-01 10 mg

Sofosbuvir Impurity 8

Ask
View Details
Sofosbuvir Impurity 8
RM-S060232-02 25 mg

Sofosbuvir Impurity 8

Ask
View Details