Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphomannomutase 1/PMM1 (C-6His)

Source: E.coli. MW :30.8kD. Recombinant Human Phosphomannomutase 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala262 is expressed with a 6His tag at the C-terminus. Phosphomannomutase 1 (PMM1) blongs to the eukaryotic PMM family. Phosphomannomutase 1 can catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose which required for a number of critical mannosyl transfer reactions. PMM1 is highly expressed in liver, heart, brain, and pancreas, but lower expression in skeletal muscle. In addition, PMM1 may be responsible for the degradation of glucose-1,6 bisphosphate in ischemic brain.

Product Specifications

Gene Name

PMM1

Gene ID

5372

UniProt

Q92871

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEAVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TXNDC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48874061 1.0 µg DNA

TXNDC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Mouse CYB5D1 shRNA Plasmid
abx983499-01 150 µg

Mouse CYB5D1 shRNA Plasmid

Ask
View Details
Mouse CYB5D1 shRNA Plasmid
abx983499-02 300 µg

Mouse CYB5D1 shRNA Plasmid

Ask
View Details
Recombinant Human Sirtuin-3
MBS144309-01 0.002 mg

Recombinant Human Sirtuin-3

Ask
View Details
Recombinant Human Sirtuin-3
MBS144309-02 0.01 mg

Recombinant Human Sirtuin-3

Ask
View Details
Recombinant Human Sirtuin-3
MBS144309-03 1 mg

Recombinant Human Sirtuin-3

Ask
View Details