Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphomannomutase 1/PMM1 (C-6His)

Source: E.coli. MW :30.8kD. Recombinant Human Phosphomannomutase 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala262 is expressed with a 6His tag at the C-terminus. Phosphomannomutase 1 (PMM1) blongs to the eukaryotic PMM family. Phosphomannomutase 1 can catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose which required for a number of critical mannosyl transfer reactions. PMM1 is highly expressed in liver, heart, brain, and pancreas, but lower expression in skeletal muscle. In addition, PMM1 may be responsible for the degradation of glucose-1,6 bisphosphate in ischemic brain.

Product Specifications

Gene Name

PMM1

Gene ID

5372

UniProt

Q92871

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEAVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VPS45A (VPS45) Human Gene Knockout Kit (CRISPR)
KN406027 1 Kit

VPS45A (VPS45) Human Gene Knockout Kit (CRISPR)

Ask
View Details
Rabbit Polyclonal RUSC2 Antibody [Alexa Fluor 532]
NBP2-81786AF532 0.1 mL

Rabbit Polyclonal RUSC2 Antibody [Alexa Fluor 532]

Ask
View Details
Bile Esculin HiVeg® Agar
MV972-500G 500 g

Bile Esculin HiVeg® Agar

Ask
View Details
Human CC16 (Clara Cell 16kD protein) ELISA Kit
RE1413H-01 48 Tests

Human CC16 (Clara Cell 16kD protein) ELISA Kit

Ask
View Details
Human CC16 (Clara Cell 16kD protein) ELISA Kit
RE1413H-02 96 Tests

Human CC16 (Clara Cell 16kD protein) ELISA Kit

Ask
View Details
PLV3-CMV-Spp1-3xHA-CopGFP-Puro Plasmid
PVT75563 2 µg

PLV3-CMV-Spp1-3xHA-CopGFP-Puro Plasmid

Ask
View Details