Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphomevalonate Kinase/PMVK (N-6His)

Source: E.coli. MW :24.2kD. Recombinant Human Podoplanin is produced by our E.coli expression system and the target gene encoding Met1-Leu192 is expressed with a 6His tag at the N-terminus. Phosphomevalonate kinase (PMVK) is a cytosolic enzyme. PMVK can be highly expressed in the heart, skeletal muscle, liver, pancreas, and kidney; it is expressed at lower levels in the brain, lung, and placenta. Induced by sterol, PMVK takes part in isopentenyl diphosphate biosynthesis through the mevalonate pathway. PMVK catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate in the fifth reaction of the cholesterol biosynthetic pathway.

Product Specifications

Gene Name

PMVK

Gene ID

10654

UniProt

Q15126

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008077-01 0.02 mg

Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Ask
View Details
Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008077-02 0.1 mg

Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Ask
View Details
Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008077-03 5x 0.1 mg

Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Ask
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os12g0240900 Polyclonal Antibody
MBS9008718 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os12g0240900 Polyclonal Antibody

Ask
View Details
Slc34a2 (NM_011402) Mouse Recombinant Protein
TP510105 20 µg

Slc34a2 (NM_011402) Mouse Recombinant Protein

Ask
View Details
Rabbit Polyclonal OTUD4 Antibody [DyLight 650]
NBP2-37690C 0.1 mL

Rabbit Polyclonal OTUD4 Antibody [DyLight 650]

Ask
View Details