Recombinant Human cAMP-dependent Protein Kinase Inhibitor beta/PKI- beta (N-6His)
Source: E.coli. MW :10.6kD. Recombinant Human PKI-beta is produced by our E.coli expression system and the target gene encoding Met1-Lys78 is expressed with a 6His tag at the N-terminus. cAMP-Dependent Protein Kinase Inhibitor beta (PKI- beta) is a member of the PKI family. It has been shown that PKI- beta is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
Product Specifications
Gene Name
PKIB
Gene ID
5570
UniProt
Q9C010
Components
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
