Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pterin-4-a-Carbinolamine Dehydratase/PHS/PCBD1 (N-6His)

Source: E.coli. MW :14.2kD. Recombinant Human PCBD1 is produced by our E.coli expression system and the target gene encoding Ala2-Thr104 is expressed with a 6His tag at the N-terminus. Pterin-4-a-Carbinolamine Dehydratase (PCBD1) is the founding member of the Pterin-4-a-Carbinolamine Dehydratase Family. PCBD1 is involved in Tetrahydrobiopterin biosynthesis. It seems to prevent the formation of 7-Pterins and accelerate the formation of Quinonoid-BH2. Furthermore, PCBD1 regulates the homodimerization of the transcription factor Hepatocyte Nuclear Factor 1 (HNF1) and enhances its transcriptional activity. Defects in PCBD1 are the cause of BH4-Deficient Hyperphenylalaninemia Type D (HPABH4D) . HPABH4D is characterized by the excretion of 7-substituted Pterins in the urine of affected patients.

Product Specifications

Gene Name

PCBD1

Gene ID

5092

UniProt

P61457

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCCAG10 (CWC27) Mouse Monoclonal Antibody [Clone ID: OTI4C8]
TA808677 100 µL

SDCCAG10 (CWC27) Mouse Monoclonal Antibody [Clone ID: OTI4C8]

Sign In for Pricing
View Details
Kcnc1 Mouse shRNA Plasmid (Locus ID 16502)
TR501151 1 Kit

Kcnc1 Mouse shRNA Plasmid (Locus ID 16502)

Sign In for Pricing
View Details
AGPAT5 Rabbit pAb
E47R12451 100 µL

AGPAT5 Rabbit pAb

Sign In for Pricing
View Details
DCP1A Antibody
MBS9411154-01 0.1 mL

DCP1A Antibody

Sign In for Pricing
View Details
DCP1A Antibody
MBS9411154-02 5x 0.1 mL

DCP1A Antibody

Sign In for Pricing
View Details
(E) -10-Hexadecenal
sc-490707 5 mg

(E) -10-Hexadecenal

Sign In for Pricing
View Details