Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pterin-4-a-Carbinolamine Dehydratase/PHS/PCBD1 (N-6His)

Source: E.coli. MW :14.2kD. Recombinant Human PCBD1 is produced by our E.coli expression system and the target gene encoding Ala2-Thr104 is expressed with a 6His tag at the N-terminus. Pterin-4-a-Carbinolamine Dehydratase (PCBD1) is the founding member of the Pterin-4-a-Carbinolamine Dehydratase Family. PCBD1 is involved in Tetrahydrobiopterin biosynthesis. It seems to prevent the formation of 7-Pterins and accelerate the formation of Quinonoid-BH2. Furthermore, PCBD1 regulates the homodimerization of the transcription factor Hepatocyte Nuclear Factor 1 (HNF1) and enhances its transcriptional activity. Defects in PCBD1 are the cause of BH4-Deficient Hyperphenylalaninemia Type D (HPABH4D) . HPABH4D is characterized by the excretion of 7-substituted Pterins in the urine of affected patients.

Product Specifications

Gene Name

PCBD1

Gene ID

5092

UniProt

P61457

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LentimiRa-hsa-miR-181a-2-3p Vector
mh41630 500 ng

LentimiRa-hsa-miR-181a-2-3p Vector

Ask
View Details
N3-Ethyl pseudouridine
HY-152417 1 Each

N3-Ethyl pseudouridine

Ask
View Details
Recombinant Human RBP2 Protein
E30P3875 20 µg

Recombinant Human RBP2 Protein

Ask
View Details