Recombinant Human Oncomodulin-1/OM (N-6His)
Source: E.coli. MW :14.3kD. Recombinant Human Oncomodulin-1 is produced by our E.coli expression system and the target gene encoding Met1-Ser109 is expressed with a 6His tag at the N-terminus. Oncomodulin-1 (OM) is a small, calcium-binding protein and a macrophage-derived growth factor, which can promote axon regeneration in retinal ganglion cells. Oncomodulin-1 is constitutively secreted by activated macrophages in the vitreous and retina in response to inflammatory conditions that promote optic nerve regeneration. Oncomodulin-1 binds RGCs with high affinity in vitro, but only when cAMP is pharmacologically elevated or if the membrane is permeabilized allowing Oncomodulin-1 access to the cytosolic compartment. Oncomodulin-1 is a member of the superfamily of calmodulin proteins and is a high-affinity calcium ion-binding protein and contains 2 EF-hand domains. OM is found in early embryonic cells in the placenta and also in tumors. It has some calmodulin-like activity with respect to enzyme activation and growth regulation.
Product Specifications
Gene Name
OCM
Gene ID
654231
UniProt
P0CE72
Components
Lyophilized from a 0.2 μm filtered solution of 50mM Tris, 100mM NaCl, pH 7.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGSSHHHHHHSSGLVPRGSHMSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items