Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PAF-AH subunit beta/PAFAHB (C-6His)

Source: E.coli. MW :26.6kD. Recombinant Human PAF-AH subunit beta is produced by our E.coli expression system and the target gene encoding Ser2-Ala229 is expressed with a 6His tag at the C-terminus. Platelet-Activating Factor Acetylhydrolase IB Subunit beta (PAFAHB) is a cytoplasmic hydrolase. PAFAHB is a member of the GDSL lipolytic enzyme family. It also belongs to Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma), PAFAHB is a catalytic subunit. PAFAHB inactivates PAF by removing the acetyl group at the sn-2 position.

Product Specifications

Gene Name

PAFAH1B2

Gene ID

5049

UniProt

P68402

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIAVEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

POLE2 (NM_002692) Human Tagged ORF Clone Lentiviral Particle
RC222113L4V 200 µL

POLE2 (NM_002692) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Genorise® Sheep RANKL Polyclonal Antibody
GR130020 100 µg

Genorise® Sheep RANKL Polyclonal Antibody

Sign In for Pricing
View Details
Mpv17l Mouse qPCR Primer Pair (NM_033564)
MP208411 200 Reactions

Mpv17l Mouse qPCR Primer Pair (NM_033564)

Sign In for Pricing
View Details
RBM17 protein (His tag)
80R-3584 50 ug

RBM17 protein (His tag)

Sign In for Pricing
View Details
Smad4 (NM_008540) Mouse Tagged ORF Clone Lentiviral Particle
MR208755L4V 200 µL

Smad4 (NM_008540) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human NFKB1 Protein
E30P571 20 µg

Recombinant Human NFKB1 Protein

Sign In for Pricing
View Details