Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PAF-AH subunit beta/PAFAHB (C-6His)

Source: E.coli. MW :26.6kD. Recombinant Human PAF-AH subunit beta is produced by our E.coli expression system and the target gene encoding Ser2-Ala229 is expressed with a 6His tag at the C-terminus. Platelet-Activating Factor Acetylhydrolase IB Subunit beta (PAFAHB) is a cytoplasmic hydrolase. PAFAHB is a member of the GDSL lipolytic enzyme family. It also belongs to Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma), PAFAHB is a catalytic subunit. PAFAHB inactivates PAF by removing the acetyl group at the sn-2 position.

Product Specifications

Gene Name

PAFAH1B2

Gene ID

5049

UniProt

P68402

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIAVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Nedd4l activation kit by CRISPRa
GA211260 1 Kit

Mouse Nedd4l activation kit by CRISPRa

Ask
View Details
MORF4LP3 3'UTR Lenti-reporter-Luc Vector
62103081 1.0 µg

MORF4LP3 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Sft2d3-set siRNA/shRNA/RNAi Lentivector (Rat)
43603096 4x 500 ng

Sft2d3-set siRNA/shRNA/RNAi Lentivector (Rat)

Ask
View Details
Lentiviral human ITSN1 shRNA (UAS) - Lentiviral human ITSN1 shRNA (UAS, iRFP) (100)
GTR15311838 1 Vial

Lentiviral human ITSN1 shRNA (UAS) - Lentiviral human ITSN1 shRNA (UAS, iRFP) (100)

Ask
View Details
Mouse MYDGF Recombinant Protein
PPT-16663 100 µg

Mouse MYDGF Recombinant Protein

Ask
View Details