Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-Dependent Kinase 4 Inhibitor C/CDKN2C (N-6His)

Source: E.coli. MW :20.3kD. Recombinant Human CDKN2C is produced by our E.coli expression system and the target gene encoding Met1-Gln168 is expressed with a 6His tag at the N-terminus. Cyclin-Dependent Kinase 4 Inhibitor C (CDKN2C) is a member of the INK4 family of cyclin dependent kinase inhibitors. CDKN2C contains 4 ANK repeats and interacts with CDK4 or CDK6. Highest levels of CDKN2C can be found in skeletal muscle, pancreas, and heart. CDKN2C inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB and prevent the activation of the CDK kinases. Studies have been shown the roles of CDKN2C gene in regulating spermatogenesis, as well as in suppressing tumorigenesis.

Product Specifications

Gene Name

CDKN2C

Gene ID

1031

UniProt

P42773

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SMARCA2-IN-10
HY-W494890 1 Each

SMARCA2-IN-10

Ask
View Details
Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit
MBS286815-01 48 Tests

Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit

Ask
View Details
Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit
MBS286815-02 96 Tests

Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit

Ask
View Details
Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit
MBS286815-03 5x 96 Tests

Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit

Ask
View Details
Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit
MBS286815-04 10x 96 Tests

Mouse Adrencocorticotropic hormone (ACTH) ELISA Kit

Ask
View Details
PRAM1 (NM_032152) Human Over-expression Lysate
LS084106-100ug 100 µg

PRAM1 (NM_032152) Human Over-expression Lysate

Ask
View Details