Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleoside Diphosphate Kinase A/NDPKA (N-6His)

Source: E.coli. MW :19.3kD. Recombinant Human Nucleoside Diphosphate Kinase A is produced by our E.coli expression system and the target gene encoding Met1-Glu152 is expressed with a 6His tag at the N-terminus. Nucleoside-Diphosphate Kinases (NDKs) are enzymes that catalyze the exchange of phosphate groups between different nucleoside diphosphates. NDKs Possesse nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3-5 exonuclease activities. NDKs involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression and required for neural development including neural patterning and cell fate determination. Prokaryotic NDK forms a functional homotetramer.There are two isoforms of NDK in humans: NDK-A and NDK-B. Both have very similar structure, and can combine in any proportion to form functional NDK hexamers.

Product Specifications

Gene Name

NME1

Gene ID

4830

UniProt

P15531

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS1603017-01 48 Well

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Ask
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS1603017-02 96 Well

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Ask
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS1603017-03 5x 96 Well

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Ask
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
MBS1603017-04 10x 96 Well

Mouse Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Ask
View Details
P-CaM Kinase II Antibody
B2013111 100 µL

P-CaM Kinase II Antibody

Ask
View Details
Donkey Synaptotagmin-1 (SYT1) ELISA Kit
MBS9368499 Inquire

Donkey Synaptotagmin-1 (SYT1) ELISA Kit

Ask
View Details