Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B (N-6His)

Source: E.coli. MW :38.8kD. Recombinant Human LDH-B is produced by our E.coli expression system and the target gene encoding Met1-Leu334 is expressed with a 6His tag at the N-terminus. L-Lactate Dehydrogenase B Chain (LDH-B) is a member of the lactate dehydrogenase family that consists of three members, LDH-A, LDH-B and LDH-C; members of this family function as powerful markers for germ cell tumors. LDH-B is an oxidoreductase that catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+. It converts pyruvate to lactate when oxygen is absent or in short supply and it performs the reverse reaction during the Cori cycle in the liver. It is also called Hydroxybutyrate Dehydrogenase (HBD) due to its ability to catalyze the oxidation of hydroxybutyrate.

Product Specifications

Gene Name

LDHB

Gene ID

3945

UniProt

P07195

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR19 AAV Vector (Human) (CMV)
50305101 1 µg

WDR19 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
14-3-3 beta Antibody (YA3955, Mouse)
HY-P84258-01 10 µL

14-3-3 beta Antibody (YA3955, Mouse)

Sign In for Pricing
View Details
14-3-3 beta Antibody (YA3955, Mouse)
HY-P84258-02 50 μL

14-3-3 beta Antibody (YA3955, Mouse)

Sign In for Pricing
View Details
14-3-3 beta Antibody (YA3955, Mouse)
HY-P84258-03 100 µL

14-3-3 beta Antibody (YA3955, Mouse)

Sign In for Pricing
View Details
Survivin
S8500-03L 100 µg

Survivin

Sign In for Pricing
View Details
Rabbit anti-elF3A/elF3510 IHC Antibody, Affinity Purified
IHC-00589 20 µg

Rabbit anti-elF3A/elF3510 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details