Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B (N-6His)

Source: E.coli. MW :38.8kD. Recombinant Human LDH-B is produced by our E.coli expression system and the target gene encoding Met1-Leu334 is expressed with a 6His tag at the N-terminus. L-Lactate Dehydrogenase B Chain (LDH-B) is a member of the lactate dehydrogenase family that consists of three members, LDH-A, LDH-B and LDH-C; members of this family function as powerful markers for germ cell tumors. LDH-B is an oxidoreductase that catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+. It converts pyruvate to lactate when oxygen is absent or in short supply and it performs the reverse reaction during the Cori cycle in the liver. It is also called Hydroxybutyrate Dehydrogenase (HBD) due to its ability to catalyze the oxidation of hydroxybutyrate.

Product Specifications

Gene Name

LDHB

Gene ID

3945

UniProt

P07195

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human CTU1 sgRNA gene knockout kit - Lentiviral human CTU1 sgRNA gene knockout kit (plasmid)
GTR15368444 1 Vial

Lentiviral human CTU1 sgRNA gene knockout kit - Lentiviral human CTU1 sgRNA gene knockout kit (plasmid)

Ask
View Details
NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody
abx404935-01 100 µL

NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody

Ask
View Details
NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody
abx404935-02 200 µL

NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody

Ask
View Details
NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody
abx404935-03 1 mL

NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody

Ask
View Details
2-chloro Palmitic Acid
MF-0049006-01 1 mg

2-chloro Palmitic Acid

Ask
View Details
2-chloro Palmitic Acid
MF-0049006-02 5 mg

2-chloro Palmitic Acid

Ask
View Details