Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 (N-6His)

Source: E.coli. MW :38.8kD. Recombinant Human LDH-A is produced by our E.coli expression system and the target gene encoding Met1-Phe332 is expressed with a 6His tag at the N-terminus. L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.

Product Specifications

Gene Name

LDHA

Gene ID

3939

UniProt

P00338

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vill (NM_001164567) Mouse Tagged ORF Clone Lentiviral Particle
MR215823L3V 200 µL

Vill (NM_001164567) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
RPL27A (V140) polyclonal antibody
BS3049-01 50 µL

RPL27A (V140) polyclonal antibody

Ask
View Details
RPL27A (V140) polyclonal antibody
BS3049-02 100 µL

RPL27A (V140) polyclonal antibody

Ask
View Details
Lentiviral human SLC2A10 shRNA (UAS) - Lentiviral human SLC2A10 shRNA (UAS, GFP) (25)
GTR15094124 1 Vial

Lentiviral human SLC2A10 shRNA (UAS) - Lentiviral human SLC2A10 shRNA (UAS, GFP) (25)

Ask
View Details
NT5C1B (NT5C1B-RDH14) (NM_001199104) Human Tagged ORF Clone Lentiviral Particle
RC231332L3V 200 µL

NT5C1B (NT5C1B-RDH14) (NM_001199104) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Krtap9-1 activation kit by CRISPRa
GA202391 1 Kit

Mouse Krtap9-1 activation kit by CRISPRa

Ask
View Details