Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 (N-6His)

Source: E.coli. MW :38.8kD. Recombinant Human LDH-A is produced by our E.coli expression system and the target gene encoding Met1-Phe332 is expressed with a 6His tag at the N-terminus. L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.

Product Specifications

Gene Name

LDHA

Gene ID

3939

UniProt

P00338

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal NAT2 Antibody
NBP1-59905 100 µL

Rabbit Polyclonal NAT2 Antibody

Ask
View Details
RBM41 (NM_001171080) Human Tagged Lenti ORF Clone
RC230013L4 10 µg

RBM41 (NM_001171080) Human Tagged Lenti ORF Clone

Ask
View Details
E-64-D
BML-PI107-0001 1 mg

E-64-D

Ask
View Details
Mouse Monoclonal B7-1/CD80 Antibody (C80/1608) [Dylight 594]
NBP2-54307DL594 0.1 mL

Mouse Monoclonal B7-1/CD80 Antibody (C80/1608) [Dylight 594]

Ask
View Details