Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hippocalcin-Like Protein 1/HPCAL1 (N-6His)

Source: E.coli. MW :24.5kD. Recombinant Human Hippocalcin-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Phe193 is expressed with a 6His tag at the N-terminus. Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system.

Product Specifications

Gene Name

HPCAL1

Gene ID

3241

UniProt

P37235

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SSBP4 Antibody
GWB-MN188H 50 µg

SSBP4 Antibody

Ask
View Details
S38A6 Rabbit Polyclonal Antibody
MBS9516830-01 0.05 mL

S38A6 Rabbit Polyclonal Antibody

Ask
View Details
S38A6 Rabbit Polyclonal Antibody
MBS9516830-02 0.1 mL

S38A6 Rabbit Polyclonal Antibody

Ask
View Details
S38A6 Rabbit Polyclonal Antibody
MBS9516830-03 5x 0.1 mL

S38A6 Rabbit Polyclonal Antibody

Ask
View Details
DNAJC10, NT (DNAJC10, ERDJ5, DnaJ homolog subfamily C member 10, ER-resident protein ERdj5, Macrothioredoxin) (FITC)
MBS6292732-01 0.2 mL

DNAJC10, NT (DNAJC10, ERDJ5, DnaJ homolog subfamily C member 10, ER-resident protein ERdj5, Macrothioredoxin) (FITC)

Ask
View Details
DNAJC10, NT (DNAJC10, ERDJ5, DnaJ homolog subfamily C member 10, ER-resident protein ERdj5, Macrothioredoxin) (FITC)
MBS6292732-02 5x 0.2 mL

DNAJC10, NT (DNAJC10, ERDJ5, DnaJ homolog subfamily C member 10, ER-resident protein ERdj5, Macrothioredoxin) (FITC)

Ask
View Details