Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hemoglobin Subunit Zeta/HBAZ (N-6His)

Source: E.coli. MW :17.8kD. Recombinant Human Hemoglobin Subunit Zeta is produced by our E.coli expression system and the target gene encoding Met1-Arg142 is expressed with a 6His tag at the N-terminus. Hemoglobin Subunit Zeta (HBZ) is a member of the Globin family. The zeta chain is an alpha-type chain of mammalian embryonic Hemoglobin that is synthesized primarily in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal growth and adult life. The HBZ gene consists of five functional genes and two pseudogenes, the order of genes is 5-zeta-pseudozeta-mu-pseudoalpha-1-alpha-2-alpha-1-theta-1-3.

Product Specifications

Gene Name

HBZ

Gene ID

3050

UniProt

P02008

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)
MBS1205234-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)
MBS1205234-02 0.02 mg (Yeast)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)
MBS1205234-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)
MBS1205234-04 0.1 mg (Yeast)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)
MBS1205234-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)
MBS1205234-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Transposase insH for insertion sequence element IS5A (insH1)

Sign In for Pricing
View Details