Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hemoglobin Subunit Zeta/HBAZ (N-6His)

Source: E.coli. MW :17.8kD. Recombinant Human Hemoglobin Subunit Zeta is produced by our E.coli expression system and the target gene encoding Met1-Arg142 is expressed with a 6His tag at the N-terminus. Hemoglobin Subunit Zeta (HBZ) is a member of the Globin family. The zeta chain is an alpha-type chain of mammalian embryonic Hemoglobin that is synthesized primarily in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal growth and adult life. The HBZ gene consists of five functional genes and two pseudogenes, the order of genes is 5-zeta-pseudozeta-mu-pseudoalpha-1-alpha-2-alpha-1-theta-1-3.

Product Specifications

Gene Name

HBZ

Gene ID

3050

UniProt

P02008

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal MED4 Antibody [DyLight 680]
NBP2-99047FR 0.1 mL

Rabbit Polyclonal MED4 Antibody [DyLight 680]

Ask
View Details
PIK3R2, NT (PIK3R2, Phosphatidylinositol 3-kinase regulatory subunit beta, Phosphatidylinositol 3-kinase 85kD regulatory subunit beta) (Biotin)
MBS6334071-01 0.2 mL

PIK3R2, NT (PIK3R2, Phosphatidylinositol 3-kinase regulatory subunit beta, Phosphatidylinositol 3-kinase 85kD regulatory subunit beta) (Biotin)

Ask
View Details
PIK3R2, NT (PIK3R2, Phosphatidylinositol 3-kinase regulatory subunit beta, Phosphatidylinositol 3-kinase 85kD regulatory subunit beta) (Biotin)
MBS6334071-02 5x 0.2 mL

PIK3R2, NT (PIK3R2, Phosphatidylinositol 3-kinase regulatory subunit beta, Phosphatidylinositol 3-kinase 85kD regulatory subunit beta) (Biotin)

Ask
View Details
DCXR, ID (Sperm Surface Protein P34H, Carbonyl Reductase II, Kidney Dicarbonyl Reductase, kiDCR, Dicarbonyl/L-xylulose Reductase, L-xylulose Reductase, XR) (MaxLight 490)
MBS6472026-01 0.1 mL

DCXR, ID (Sperm Surface Protein P34H, Carbonyl Reductase II, Kidney Dicarbonyl Reductase, kiDCR, Dicarbonyl/L-xylulose Reductase, L-xylulose Reductase, XR) (MaxLight 490)

Ask
View Details
DCXR, ID (Sperm Surface Protein P34H, Carbonyl Reductase II, Kidney Dicarbonyl Reductase, kiDCR, Dicarbonyl/L-xylulose Reductase, L-xylulose Reductase, XR) (MaxLight 490)
MBS6472026-02 5x 0.1 mL

DCXR, ID (Sperm Surface Protein P34H, Carbonyl Reductase II, Kidney Dicarbonyl Reductase, kiDCR, Dicarbonyl/L-xylulose Reductase, L-xylulose Reductase, XR) (MaxLight 490)

Ask
View Details
Lutikizumab Biosimilar (Monoclonal, IgG1-kappa (DVD-Ig) )
A134799 100 µL

Lutikizumab Biosimilar (Monoclonal, IgG1-kappa (DVD-Ig) )

Ask
View Details