Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm4/LSM4 (N-6His)

Source: E.coli. MW :17.5kD. Recombinant Human LSM4 is produced by our E.coli expression system and the target gene encoding Met1-Gln139 is expressed with a 6His tag at the N-terminus. U6 snRNA-associated Sm-like protein LSm4 (LSM4) is a member of the snRNP Sm proteins family. Sm-like proteins contain the Sm sequence motif and are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing. LSM4 forms a heteromer with a donut shape. The complexes are involved in various steps of RNA metabolism. LSM4 binds specifically to the 3-terminal U-tract of U6 snRNA. LSM4 contributes RNA protein interactions and structural changes which are essential during ribosomal subunit assembly.

Product Specifications

Gene Name

LSM4

Gene ID

25804

UniProt

Q9Y4Z0

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ