Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glial Cell Line-Derived Neurotrophic Factor/GDNF

Source: E.coli. MW :15.1kD. Recombinant Human GDNF is produced by our E.coli expression system and the target gene encoding Ser78-Ile211 is expressed. Glial Cell Line-Derived Neurotrophic Factor (GDNF) is a disulfide-linked homodimeric glycoprotein that belongs to the TGF- beta superfamily. It has been shown to promote the survival of various neuronal subpopulations in both the central as well as the peripheral nervous systems at different stages of their development. Human GDNF cDNA encodes a 211 amino acid residue prepropeptide that is processed to yield a dimeric protein. Mature human GDNF was predicted to contain two 134 amino acid residue subunits. Cells known to express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells. Mutations in this gene may be associated with Hirschsprung disease.

Product Specifications

Gene Name

GDNF

Gene ID

2668

UniProt

P39905

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.25.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)
MBS6396154-01 0.1 mL

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)

Ask
View Details
TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)
MBS6396154-02 5x 0.1 mL

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)

Ask
View Details
Fmoc- (R) -4-amino-5-tert-butoxypentanoic acid 99+% (HPLC)
237864-01 250 mg

Fmoc- (R) -4-amino-5-tert-butoxypentanoic acid 99+% (HPLC)

Ask
View Details
Fmoc- (R) -4-amino-5-tert-butoxypentanoic acid 99+% (HPLC)
237864-02 1 g

Fmoc- (R) -4-amino-5-tert-butoxypentanoic acid 99+% (HPLC)

Ask
View Details
Fmoc- (R) -4-amino-5-tert-butoxypentanoic acid 99+% (HPLC)
237864-03 2.5 g

Fmoc- (R) -4-amino-5-tert-butoxypentanoic acid 99+% (HPLC)

Ask
View Details
YES1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61846R-PerCP-Cy5.5 100 µL

YES1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Ask
View Details