Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 21/FGF-21 (N-6His)

Source: E.coli. MW :21.69kD. Recombinant Human Fibroblast Growth Factor 21 is produced by our E.coli expression system and the target gene encoding His29-Ser209 is expressed with a 6His tag at the N-terminus. Fibroblast Growth Factor 21 (FGF21) is a growth factor that belongs to the FGF family. FGF family proteins play a central role during prenatal development and postnatal growth and regeneration of mamy tissues, by promoting cellular proliferation and differentiation. FGF21 is a potent activator of glucose uptake on adipocytes, protects animal from diet-induced obesity when overexpression in transgenic mice, and lower blood glucose and triglyceride levels when therapeutically adiministered to diabetic redents. FGF21 is produced by hepatocytes in reponse to free fatty acid stimulation of a PPARa/RXR dimeric complex. This situation occurs clinically during starvation, or following the ingestionof a highly-fat/low-carbohydrate diet.Upon FGF21 secretion, white adipose tissue is induced to release free fatty acids from triglyceride stores. Once free fatty acid reach hepatocytes, they are oxidized and reduced to acetyl-CoA. The acetyl-CoA is recombined into 4-carbon ketone bodies, release, and transported to peripheral tissue for TCA processing and energy generation.

Product Specifications

Gene Name

FGF21

Gene ID

26291

UniProt

Q9NSA1

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 2mM EDTA, pH9.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

USP7 Mouse Monoclonal Antibody [Clone ID: OTI3F7]
TA504063S 30 µL

USP7 Mouse Monoclonal Antibody [Clone ID: OTI3F7]

Ask
View Details
PDIA6 Rabbit pAb
E47R12597 100 µL

PDIA6 Rabbit pAb

Ask
View Details
Rat Monoclonal BAFF Receptor Antibody (7J21) [Alexa Fluor 405]
NBP2-22005AF405 0.1 mL

Rat Monoclonal BAFF Receptor Antibody (7J21) [Alexa Fluor 405]

Ask
View Details
Rabbit Anti-Human WT1 pAb
PA5708-01 50 μL

Rabbit Anti-Human WT1 pAb

Ask
View Details
Rabbit Anti-Human WT1 pAb
PA5708-02 100 μL

Rabbit Anti-Human WT1 pAb

Ask
View Details
EGFR pThr693 Rabbit Polyclonal Antibody
AP02462PU-S 50 µL

EGFR pThr693 Rabbit Polyclonal Antibody

Ask
View Details